Awaiting product image

CXCL8 (50190P-1000)

$2,503.00

Host Quantity Applications Species Reactivity Data Sheet  
1000ug Migration assay Human
SKU: 50190P-1000 Categories: ,
Overview
Product Name CXCL8 (50190P-1000)
Description Recombinant human CXCL8 is produced in E. coli
Target CXCL8
Species Reactivity Human
Applications Migration assay
Source Recombinant human CXCL8 is produced in E. coli
Properties
Form Lyophilized
Molecular Mass 8.386 kDa
Purity >97% by SDS-PAGE
Background The small cytokine CXCL8 (also known as IL-8) is known to be one of the most potent chemoattractant molecules that, among several other functions, is responsible for guiding neutrophils through the tissue matrix until they reach sites of injury. IL-8 is also a potent promoter of angiogenesis. In target cells, IL-8 binds to two cell surface receptors, CXCR1 and CXCR2, and induces a series of physiological responses required for migration and phagocytosis, such as increase of intracellular Ca2+, exocytosis (e.g. histamine release), and respiratory burst. IL-8 is a member of the CXC chemokine family. The genes encoding this and the other ten members of the CXC chemokine family form a cluster in a region mapped to chromosome 4q.
Specificity Information
Target Name Interleukin-8
Target ID CXCL8
Alternative Names rHuCXCL8, IL-8
Sequence Location Secreted.
Sequence SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGR ELCLDPKENWVQRVVEKFLKRAENS
Biological Activity CXCL8
Biological Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. {PubMed:11978786, PubMed:2145175, PubMed:2212672}.
Background The small cytokine CXCL8 (also known as IL-8) is known to be one of the most potent chemoattractant molecules that, among several other functions, is responsible for guiding neutrophils through the tissue matrix until they reach sites of injury. IL-8 is also a potent promoter of angiogenesis. In target cells, IL-8 binds to two cell surface receptors, CXCR1 and CXCR2, and induces a series of physiological responses required for migration and phagocytosis, such as increase of intracellular Ca2+, exocytosis (e.g. histamine release), and respiratory burst. IL-8 is a member of the CXC chemokine family. The genes encoding this and the other ten members of the CXC chemokine family form a cluster in a region mapped to chromosome 4q.
Application Images
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration of recombinant CXCR1- expressing cells.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet