Awaiting product image

CCL7, biotinylated (50189PB-2)

$153.00

Host Quantity Applications Species Reactivity Data Sheet  
2ug Migration assay Human
SKU: 50189PB-2 Categories: ,
Overview
Product Name CCL7, biotinylated (50189PB-2)
Description Recombinant human CCL7 is produced in E. coli
Target CCL7ylated
Species Reactivity Human
Applications Migration assay
Conjugate Biotin
Associated Products #1112 Anti-Human CCR5 Antibody 50189PB-2 2ug
Source Recombinant human CCL7 is produced in E. coli
Properties
Form Lyophilized
Molecular Mass 11.2 kDa
Purity >97% by SDS-PAGE
Background CCL7, also known as Monocyte Chemotactic Protein-3 (MCP-3), is a secreted chemokine that attracts macrophages, monocytes, and eosinophils during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. In vivo, this protein is a substrate of matrix metalloproteinase 2 (MMP2), an enzyme that degrades components of the extracellular matrix. The gene that encodes CCL7 is part of a cluster of C-C chemokine family members on chromosome 17q. CCL7 binds to CCR1, CCR2, and CCR3 receptors and appears to be an antagonist for the CCR5 receptor.
Specificity Information
Target Name C-C motif chemokine 7
Target ID CCL7ylated
Alternative Names rHuCCL7-biotin, MCP-3
Sequence Location Secreted.
Sequence QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFK TKLDKEICADPTQKWVQDFMKHLDKKTQTPKLKLGSGLNDIFE AQKIEWHE
Biological Activity CCL7ylated
Biological Function Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
Background CCL7, also known as Monocyte Chemotactic Protein-3 (MCP-3), is a secreted chemokine that attracts macrophages, monocytes, and eosinophils during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. In vivo, this protein is a substrate of matrix metalloproteinase 2 (MMP2), an enzyme that degrades components of the extracellular matrix. The gene that encodes CCL7 is part of a cluster of C-C chemokine family members on chromosome 17q. CCL7 binds to CCR1, CCR2, and CCR3 receptors and appears to be an antagonist for the CCR5 receptor.
Application Images
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration of recombinant CCR2- expressing cells.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet