Overview
Product Name CCL7 (50188P-50)
Description Recombinant human CCL7 is produced in E. coli
Target CCL7
Species Reactivity Human
Applications Migration assay
Associated Products #1112 Anti-Human CCR5 Antibody 50188P-2 2ug
Source Recombinant human CCL7 is produced in E. coli
Properties
Form Lyophilized
Molecular Mass 8.956 kDa
Purity >97% by SDS-PAGE
Background CCL7, also known as Monocyte Chemotactic Protein-3 (MCP-3), is a secreted chemokine that attracts macrophages, monocytes, and eosinophils during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. In vivo, this protein is a substrate of matrix metalloproteinase 2 (MMP2), an enzyme that degrades components of the extracellular matrix. The gene that encodes CCL7 is part of a cluster of C-C chemokine family members on chromosome 17q. CCL7 binds to CCR1, CCR2, and CCR3 receptors and appears to be an antagonist for the CCR5 receptor.
Specificity Information
Target Name C-C motif chemokine 7
Target ID CCL7
Alternative Names rHuCCL7, MCP-3
Sequence Location Secreted.
Sequence QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFK TKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
Biological Activity CCL7
Biological Function Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
Background CCL7, also known as Monocyte Chemotactic Protein-3 (MCP-3), is a secreted chemokine that attracts macrophages, monocytes, and eosinophils during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. In vivo, this protein is a substrate of matrix metalloproteinase 2 (MMP2), an enzyme that degrades components of the extracellular matrix. The gene that encodes CCL7 is part of a cluster of C-C chemokine family members on chromosome 17q. CCL7 binds to CCR1, CCR2, and CCR3 receptors and appears to be an antagonist for the CCR5 receptor.
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration of recombinant CCR2- expressing cells.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet
Data Sheet Download PDF Data Sheet