Overview
Product Name CCL28 (50183P-1000)
Description Recombinant human CCL28, produced in E. coli, corresponds to aa 23- 127
Target CCL28
Species Reactivity Human
Applications Migration assay
Source Recombinant human CCL28, produced in E. coli
Properties
Form Lyophilized
Molecular Mass 12.073 kDa
Purity >97%
Background CCL28, also known as Mucosae-associated Epithelial Chemokine (MEC), is secreted by gastrointestinal and non-intestinal mucosal cells. It regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. This chemokine is constitutively expressed in the colon, but its levels can be increased by pro-inflammatory cytokines and certain bacterial products implying a role in effector cell recruitment to sites of epithelial injury. CCL28 has also been implicated in the migration of IgA-expressing cells to the mammary gland, salivary gland, intestine and other mucosal tissues. It has also been shown as a potential antimicrobial agent effective against certain pathogens, such as Gram negative and Gram positive bacteria and the fungus Candida albicans.
Specificity Information
Target Name C-C motif chemokine 28
Target ID CCL28
Alternative Names rHuCCL28, MEC
Sequence Location Secreted.
Sequence ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY
Biological Activity CCL28
Biological Function Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.
Background CCL28, also known as Mucosae-associated Epithelial Chemokine (MEC), is secreted by gastrointestinal and non-intestinal mucosal cells. It regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. This chemokine is constitutively expressed in the colon, but its levels can be increased by pro-inflammatory cytokines and certain bacterial products implying a role in effector cell recruitment to sites of epithelial injury. CCL28 has also been implicated in the migration of IgA-expressing cells to the mammary gland, salivary gland, intestine and other mucosal tissues. It has also been shown as a potential antimicrobial agent effective against certain pathogens, such as Gram negative and Gram positive bacteria and the fungus Candida albicans.
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration Assay in L1.2 cells expressing CCR10.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month, 2°C to 8°C, under sterile conditions after reconstitution. 3 months, -20°C to -70°C, under sterile conditions after reconstitution.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet
Data Sheet Download PDF Data Sheet