Overview
Product Name CCL27 (50182P-100)
Description Recombinant human CCL27, produced in E. coli, corresponds to aa 25- 112
Target CCL27
Species Reactivity Human
Applications Migration assay
Source Recombinant human CCL27, produced in E. coli
Properties
Form Lyophilized
Molecular Mass 10.149 kDa
Purity >97%
Background CCL27, also known as Cutaneous T-cell-attracting Chemokine (CTACK) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T-cells during cutaneous inflammation. Interestingly, after CCR10-mediated internalization, CCL27, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior.
Specificity Information
Target Name C-C motif chemokine 27
Target ID CCL27
Alternative Names rHuCCL27, CTACK
Sequence Location Secreted
Sequence FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQ RSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Biological Activity CCL27
Biological Function Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10.
Background CCL27, also known as Cutaneous T-cell-attracting Chemokine (CTACK) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T-cells during cutaneous inflammation. Interestingly, after CCR10-mediated internalization, CCL27, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior.
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration Assay in L1.2 cells expressing CCR10.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month, 2°C to 8°C, under sterile conditions after reconstitution. 3 months, -20°C to -70°C, under sterile conditions after reconstitution.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet
Data Sheet Download PDF Data Sheet