Awaiting product image

CCL14 (50192P-100)

$551.00

Host Quantity Applications Species Reactivity Data Sheet  
100ug Migration assay Human
SKU: 50192P-100 Categories: ,
Overview
Product Name CCL14 (50192P-100)
Description Recombinant human CCL14 is produced in E. coli
Target CCL14
Species Reactivity Human
Applications Migration assay
Source Recombinant human CCL14 is produced in E. coli
Properties
Form Lyophilized
Molecular Mass 7.801 kDa
Purity >97% by SDS-PAGE
Background CCL14, also known as Hemofiltrate CC Chemokine-1 (HCC-1) is a small cytokine (~8kDa) that is constitutively expressed in multiple tissues. Upon processing of the N-terminal residues of full- length HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5, and, to a lesser extent, CCR3. CCL14 causes chemotaxis of different types of leukocytes, and its active form is a potent inhibitor of HIV entry.
Specificity Information
Target Name C-C motif chemokine 14
Target ID CCL14
Alternative Names rHuCCL14, HCC-1
Sequence Location Secreted.
Sequence GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVC TNPSDKWVQDYIKDMKEN
Biological Activity CCL14
Biological Function Has weak activities on human monocytes and acts via receptors that also rPubMed:11085751}.
Background CCL14, also known as Hemofiltrate CC Chemokine-1 (HCC-1) is a small cytokine (~8kDa) that is constitutively expressed in multiple tissues. Upon processing of the N-terminal residues of full- length HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5, and, to a lesser extent, CCR3. CCL14 causes chemotaxis of different types of leukocytes, and its active form is a potent inhibitor of HIV entry.
Application Images
Additional Information
Additional Information Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.Migration Assay in cells expressing CCR1.
Handling
Storage 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Dilution Instructions Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
References & Data Sheet